Protein Info for RR42_RS19695 in Cupriavidus basilensis FW507-4G11

Annotation: cytochrome C protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 109 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF00034: Cytochrom_C" amino acids 23 to 103 (81 residues), 42.5 bits, see alignment E=1.4e-14 PF13442: Cytochrome_CBB3" amino acids 23 to 102 (80 residues), 27.3 bits, see alignment E=3.7e-10

Best Hits

Swiss-Prot: 52% identical to CY552_NITEU: Cytochrome c-552 (cyt) from Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)

KEGG orthology group: None (inferred from 92% identity to cti:RALTA_A3023)

Predicted SEED Role

"Sulfite dehydrogenase cytochrome subunit SoxD" in subsystem Sulfur oxidation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YL32 at UniProt or InterPro

Protein Sequence (109 amino acids)

>RR42_RS19695 cytochrome C protein (Cupriavidus basilensis FW507-4G11)
MKQFVIATLMLACAASANAAVDAAKAQEIANKNACMGCHQVDKKLVGPAYKDVAAKYKGD
KNALATLTKKVKGGGSGVWGPVPMPANAALSDADLKTVVEWVLAGAPAK