Protein Info for RR42_RS19465 in Cupriavidus basilensis FW507-4G11

Annotation: AsnC family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 163 PF13412: HTH_24" amino acids 6 to 53 (48 residues), 73.6 bits, see alignment E=1.1e-24 PF13404: HTH_AsnC-type" amino acids 6 to 47 (42 residues), 67.4 bits, see alignment E=1.1e-22 PF01037: AsnC_trans_reg" amino acids 73 to 150 (78 residues), 70.7 bits, see alignment E=1.2e-23

Best Hits

Swiss-Prot: 40% identical to LRP_SALTY: Leucine-responsive regulatory protein (lrp) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03719, Lrp/AsnC family transcriptional regulator, leucine-responsive regulatory protein (inferred from 94% identity to reu:Reut_A3216)

Predicted SEED Role

"Leucine-responsive regulatory protein, regulator for leucine (or lrp) regulon and high-affinity branched-chain amino acid transport system" in subsystem Branched-Chain Amino Acid Biosynthesis or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YEX3 at UniProt or InterPro

Protein Sequence (163 amino acids)

>RR42_RS19465 AsnC family transcriptional regulator (Cupriavidus basilensis FW507-4G11)
MSKVELDKIDRKILEVLQTNGRLTNLEVAERVNLSPSPCLRRIRRLEEVGVIRQYAALLE
PGRIGLGLLAYINVRLEKHGGAPKGKAPLDLFRAAIEIWPEVAACHAMTGEMDLLLKVYV
EDMEHFARFMKDHLLAHPAVIDVRSSFALECIKDTTALPVPGG