Protein Info for RR42_RS19335 in Cupriavidus basilensis FW507-4G11

Annotation: 50S ribosomal protein L1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 TIGR01169: ribosomal protein uL1" amino acids 3 to 228 (226 residues), 340.4 bits, see alignment E=2.1e-106 PF00687: Ribosomal_L1" amino acids 33 to 220 (188 residues), 225 bits, see alignment E=3.6e-71

Best Hits

Swiss-Prot: 97% identical to RL1_CUPNH: 50S ribosomal protein L1 (rplA) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K02863, large subunit ribosomal protein L1 (inferred from 97% identity to reh:H16_A3500)

MetaCyc: 68% identical to 50S ribosomal subunit protein L1 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L1p (L10Ae)" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y7A3 at UniProt or InterPro

Protein Sequence (231 amino acids)

>RR42_RS19335 50S ribosomal protein L1 (Cupriavidus basilensis FW507-4G11)
MAKVSKRTAANKAKIERTKFYPIDEALGLVKGCASAKFDESIDVAVQLGIDAKKSDQVVR
GSVVLPAGTGKSVRVAVFAQGEKAEAAKAAGAEIVGMEDLAEQVKAGNLNFDVVIASPDT
MRIVGTLGQILGPRGLMPNPKVGTVTPDVAQAVKNAKAGQVQYRVDKAGIIHATIGRRSF
QDADLKRNLSALIEALVKSKPATSKGVYLRKIAVSSTMGVGVRVEQASLSA