Protein Info for RR42_RS19060 in Cupriavidus basilensis FW507-4G11

Annotation: sulfoxide reductase catalytic subunit YedY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 transmembrane" amino acids 31 to 49 (19 residues), see Phobius details PF00174: Oxidored_molyb" amino acids 107 to 261 (155 residues), 119.9 bits, see alignment E=4.3e-39

Best Hits

Swiss-Prot: 76% identical to MSRP_RALSO: Protein-methionine-sulfoxide reductase catalytic subunit MsrP (msrP) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K07147, (no description) (inferred from 87% identity to reh:H16_A3445)

Predicted SEED Role

"Putative sulfite oxidase subunit YedY"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YH30 at UniProt or InterPro

Protein Sequence (333 amino acids)

>RR42_RS19060 sulfoxide reductase catalytic subunit YedY (Cupriavidus basilensis FW507-4G11)
MLIPSPKWLRGDDIAASEITPRGVFDARRRLLALAAAGAAGSTLAPWFARDAHAQAPRGQ
KLPATPNNAYVVPEKRTPYEDVTTYNNYYEFGTDKADPARNAGTLRTRPWQVAVEGLVKK
PKVYDIDELVRLMPMEERVYRLRCVEGWSMVIPWSGYALAELVRRVEPQPGAKYVEFVTL
NDKKQMPGVSARVLDWPYTEGLRMDEAMHPLTLLAFGLYGEVLPNQNGAPVRVVVPWKYG
FKSAKSIVKIRFVDKQPATSWNLAAAQEYGFYSNVNPDVDHPRWSQATERRIGEDKGSGF
GALFAPKRKTLPFNGYGQQVASLYQGMDLRKFF