Protein Info for RR42_RS18885 in Cupriavidus basilensis FW507-4G11

Annotation: imidazole glycerol phosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00735: imidazoleglycerol phosphate synthase, cyclase subunit
  • amino acids 1 to 255 (255 residues), 372.9 bits, E=3.5e-116
• PF00977: His_biosynth
  • amino acids 5 to 238 (234 residues), 291.7 bits, E=7.5e-91

Best Hits

Swiss-Prot: 96% identical to HIS6_CUPNJ: Imidazole glycerol phosphate synthase subunit HisF (hisF) from Cupriavidus necator (strain JMP 134 / LMG 1197)

KEGG orthology group: K02500, cyclase [EC: 4.1.3.-] (inferred from 95% identity to rme:Rmet_3242)

Predicted SEED Role

"Imidazole glycerol phosphate synthase cyclase subunit (EC 4.1.3.-)" in subsystem Histidine Biosynthesis (EC 4.1.3.-)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
• L-histidine biosynthesis (10/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.1.3.-

Use Curated BLAST to search for 4.1.3.-

Sequence Analysis Tools

See A0A0C4YH02 at UniProt or InterPro

Protein Sequence (256 amino acids)

>RR42_RS18885 imidazole glycerol phosphate synthase (Cupriavidus basilensis FW507-4G11)
MLAKRIIPCLDVTNGRVVKGVNFVELRDAGDPVEIARRYDEQGADEITFLDITATSDGRD
LILHIIEAVASQVFIPLTVGGGVRAVEDVRRLLNAGADKISVNSSAIANPQLVSDATARY
GSQCIVVAIDAKRSSAPGEPARWEVFTHGGRKATGLDAVAWAREMAARGAGELLLTSMDR
DGTKSGFDLELTRAVSDAVSVPVIASGGVGSLKDLADGIKLGHADAVLAASIFHYGEHTV
GEAKAFMAREGIPVRI