Protein Info for RR42_RS18880 in Cupriavidus basilensis FW507-4G11

Annotation: phosphoribosyl-AMP cyclohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01502: PRA-CH
  • amino acids 31 to 105 (75 residues), 121 bits, E=7.7e-40

Best Hits

Swiss-Prot: 94% identical to HIS3_CUPNJ: Phosphoribosyl-AMP cyclohydrolase (hisI) from Cupriavidus necator (strain JMP 134 / LMG 1197)

KEGG orthology group: K01496, phosphoribosyl-AMP cyclohydrolase [EC: 3.5.4.19] (inferred from 94% identity to rme:Rmet_3241)

Predicted SEED Role

"Phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19)" in subsystem Histidine Biosynthesis (EC 3.5.4.19)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
• L-histidine biosynthesis (10/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Histidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.19

Sequence Analysis Tools

See A0A0C4YEG9 at UniProt or InterPro

Protein Sequence (135 amino acids)

>RR42_RS18880 phosphoribosyl-AMP cyclohydrolase (Cupriavidus basilensis FW507-4G11)
MAKKWLNKVKWDDNGLVPVIVQEVGSNDVLMFAFMNREALQRTAEIGEAVFWSRSRKRLW
HKGEESGHVQKVHEMRLDCDEDVVLLKVTQNDGIACHTGRHSCFFQKFEGDAESGDWQTV
EPVLKDPSTIYAAKP