Protein Info for RR42_RS18850 in Cupriavidus basilensis FW507-4G11

Annotation: preprotein translocase subunit TatC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 transmembrane" amino acids 32 to 52 (21 residues), see Phobius details amino acids 85 to 106 (22 residues), see Phobius details amino acids 122 to 148 (27 residues), see Phobius details amino acids 169 to 193 (25 residues), see Phobius details amino acids 205 to 222 (18 residues), see Phobius details amino acids 228 to 246 (19 residues), see Phobius details TIGR00945: twin arginine-targeting protein translocase TatC" amino acids 22 to 239 (218 residues), 226.7 bits, see alignment E=1.6e-71 PF00902: TatC" amino acids 23 to 234 (212 residues), 236 bits, see alignment E=1.9e-74

Best Hits

Swiss-Prot: 53% identical to TATC_HAEIN: Sec-independent protein translocase protein TatC (tatC) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K03118, sec-independent protein translocase protein TatC (inferred from 86% identity to cti:RALTA_A2862)

MetaCyc: 50% identical to twin arginine protein translocation system - TatC protein (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-181

Predicted SEED Role

"Twin-arginine translocation protein TatC" in subsystem Cluster-based Subsystem Grouping Hypotheticals - perhaps Proteosome Related or Twin-arginine translocation system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y723 at UniProt or InterPro

Protein Sequence (265 amino acids)

>RR42_RS18850 preprotein translocase subunit TatC (Cupriavidus basilensis FW507-4G11)
MSDSRSQDPQDPQDDGPQETFISHLVELRSRIVKAASGVILVFVSLVYWAPNIYNLFARP
LMESLPKGGRMIVTDVTGSFFVPMKVTLLVAFLIALPWVLYQIWQFVAPGLYQHEKRLIV
PLVSSSYILFICGVAFAYFLVFPTVFHFMAHYNAPLGAEMSTDIDKYLSFAMTMFLAFGI
TFEVPVVVIVLVRFGVVELEKLKQIRPYVIVGAFVIAAVVTPPDVLSQLLLAVPLIALYE
LGLIMARFTTKPVAADAAASEAQAD