Protein Info for RR42_RS18840 in Cupriavidus basilensis FW507-4G11

Annotation: 2-alkenal reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR02037: peptidase Do" amino acids 62 to 383 (322 residues), 441.3 bits, see alignment E=2e-136 PF00089: Trypsin" amino acids 113 to 275 (163 residues), 74 bits, see alignment E=4.7e-24 PF13365: Trypsin_2" amino acids 116 to 250 (135 residues), 125.5 bits, see alignment E=8.8e-40 PF00595: PDZ" amino acids 287 to 362 (76 residues), 39.7 bits, see alignment E=1.6e-13 PF13180: PDZ_2" amino acids 291 to 378 (88 residues), 57.3 bits, see alignment E=4.9e-19 PF17820: PDZ_6" amino acids 316 to 369 (54 residues), 49.4 bits, see alignment 1e-16

Best Hits

KEGG orthology group: K01362, [EC: 3.4.21.-] (inferred from 92% identity to reh:H16_A3401)

Predicted SEED Role

"Outer membrane stress sensor protease DegS" in subsystem Proteolysis in bacteria, ATP-dependent

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YEK5 at UniProt or InterPro

Protein Sequence (397 amino acids)

>RR42_RS18840 2-alkenal reductase (Cupriavidus basilensis FW507-4G11)
MLRRFWLFFAQAVTVVLAVWFVVATLKPEWLQRGRVAVQSGSPIVALKEVVPNVAGSSAP
GSYSEAAQQAMPAVVNIFTSKNGNKQTPNPQAEDPWFRFFFGDRLPERREPVSSLGSGVI
VSAEGYILTNHHVVDGADEIEVALTDGRKANAKVVGSDPETDLAVLKITLKELPAITLGR
IENVKVGDVVLAIGNPFGVGQTVTMGIVSALGRSHLGINTFENFIQTDAAINPGNSGGAL
VDAQGNLLGVNTAIYSRSGGSLGIGFAIPVSTAKQVMESIISTGSVTRGWIGVEPQDMTP
EIAESFGLEAKEGALIAAVVQGGPADKAGVKPGDVLVSVDGQSITDTTALLNAIAQLKPG
AEARMKVVRRGRPTELTVMIGKRPPPPRRALPLDEEE