Protein Info for RR42_RS18530 in Cupriavidus basilensis FW507-4G11

Annotation: chloride channel protein EriC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 490 transmembrane" amino acids 56 to 79 (24 residues), see Phobius details amino acids 91 to 111 (21 residues), see Phobius details amino acids 151 to 166 (16 residues), see Phobius details amino acids 201 to 225 (25 residues), see Phobius details amino acids 238 to 257 (20 residues), see Phobius details amino acids 275 to 296 (22 residues), see Phobius details amino acids 317 to 337 (21 residues), see Phobius details amino acids 356 to 375 (20 residues), see Phobius details amino acids 383 to 405 (23 residues), see Phobius details amino acids 411 to 435 (25 residues), see Phobius details amino acids 444 to 462 (19 residues), see Phobius details PF00654: Voltage_CLC" amino acids 105 to 460 (356 residues), 280.6 bits, see alignment E=9.7e-88

Best Hits

KEGG orthology group: None (inferred from 82% identity to reu:Reut_A3055)

Predicted SEED Role

"Chloride channel protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YEE2 at UniProt or InterPro

Protein Sequence (490 amino acids)

>RR42_RS18530 chloride channel protein EriC (Cupriavidus basilensis FW507-4G11)
MNDVTPNRSQAPEPSDPDDVSGLASEHNRLRALRRRARMAAGRKSRQMWRISRTTLRYAV
FMCGAGCVALFSLIFAWIAEVALRWNAHLTAATPWLAFVLLPFGLAALRWLTIRLAPQAR
GSGIPQVIAAFGLPPAGPAQTLLVSFRQSMWKVLLTTGGLLAGASIGREGPSVQVGAAAM
LAWGRWCHEKLRFRIGFHPNALIAAGAAGGLAAAFNTPLAGVVFAIEELGRGTAVRWDRL
VLSGVLTAGFLSLAMLGNNPYFSVKTPILALHDAWGPVLLCALVNGVLGGLFAKLLSGGV
PALMPARLRAWPSQHPVQVAFVCGLVAAAIGWSTGGATFGTGYEQAAGLINGEPHATLWF
GLAKLAATVVSYFAGIPGGIFTPSLAIGAGIGANVADWVGHLFGAMAEPRVLALVSMAAF
LAAATQAPITASVIVMEMTRSQDLTLFLLASSLLASFLARQFCPHPFYHHVGHAFRREAL
AATRKVAPTT