Protein Info for RR42_RS18515 in Cupriavidus basilensis FW507-4G11

Annotation: dihydrodipicolinate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00036: 4-hydroxy-tetrahydrodipicolinate reductase
  • amino acids 5 to 266 (262 residues), 143 bits, E=6.7e-46
• PF01113: DapB_N
  • amino acids 5 to 128 (124 residues), 63.9 bits, E=2.5e-21
• PF03447: NAD_binding_3
  • amino acids 45 to 120 (76 residues), 24.3 bits, E=6.6e-09
• PF05173: DapB_C
  • amino acids 132 to 265 (134 residues), 64 bits, E=2.3e-21

Best Hits

KEGG orthology group: K00215, dihydrodipicolinate reductase [EC: 1.3.1.26] (inferred from 87% identity to reh:H16_A3348)

Predicted SEED Role

"4-hydroxy-tetrahydrodipicolinate reductase (EC 1.17.1.8)" (EC 1.17.1.8)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
• L-lysine biosynthesis I (9/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• L-lysine biosynthesis III (6/7 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• L-lysine biosynthesis II (7/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Lysine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.17.1.8, 1.3.1.26

Use Curated BLAST to search for 1.17.1.8 or 1.3.1.26

Sequence Analysis Tools

See A0A0C4Y6V6 at UniProt or InterPro

Protein Sequence (269 amino acids)

>RR42_RS18515 dihydrodipicolinate reductase (Cupriavidus basilensis FW507-4G11)
MSNRIRVAVGGVTGWAGGELARGVAHADDMTLVAGLSRGAAGQALAALTAHKGTPGVAVA
SIDELAQGAFDVYVEYTKPDIAKRNILQALAKGAHVVVGTSGLSDEDYAEIDAAARQARR
GVLACGNFAITVVLLQKFAEMAARHLEHWEIIDYAKAGKIDVPSGTVRELAYRLGQVREA
RQAVPIDQVKGPKETRGATMSGSQVHAVRLPGYQLGVEVIFGADGQRLHLKHESGDGSKP
YVSGALLAIRKVHALTGLVRGLDKVMEGL