Protein Info for RR42_RS18445 in Cupriavidus basilensis FW507-4G11

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 transmembrane" amino acids 38 to 61 (24 residues), see Phobius details amino acids 67 to 85 (19 residues), see Phobius details amino acids 97 to 114 (18 residues), see Phobius details amino acids 126 to 143 (18 residues), see Phobius details amino acids 150 to 168 (19 residues), see Phobius details amino acids 179 to 200 (22 residues), see Phobius details amino acids 220 to 239 (20 residues), see Phobius details amino acids 252 to 272 (21 residues), see Phobius details amino acids 284 to 312 (29 residues), see Phobius details amino acids 318 to 337 (20 residues), see Phobius details amino acids 343 to 364 (22 residues), see Phobius details PF14351: DUF4401" amino acids 33 to 366 (334 residues), 180.1 bits, see alignment E=3.8e-57

Best Hits

KEGG orthology group: None (inferred from 60% identity to reh:H16_A3335)

Predicted SEED Role

"FIG00974141: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YE92 at UniProt or InterPro

Protein Sequence (373 amino acids)

>RR42_RS18445 hypothetical protein (Cupriavidus basilensis FW507-4G11)
MTSDRQVVQRLWQDLAARGLVQGQPQAAQGRTPWAVRLLMGLAGWLGAVFFLAFLLGSVF
VAARDNATAMALCGAAMIALAAVLYRRRAAATALEQFALAVSLSGQGLLVYGASQAYGGS
RLLESAAFWGALALLEAVLYVLVSNRLHRFLAALGVWTGVALALHLAMTPGLRHVWQAMS
FSLGWLAPLAMTLLTGFVLAQGRLCAAGLHNWIEPAADATLLFALGAALVVTGLSQPQAL
LFEASTGRHAGNYWMAGALFGLVLAAFVLAEASRLQLSPAVRGTALVGAALFSALLAGAP
AVVAAALALGLALRRSSLPWLGLAVAALGSGFIWYYSALHWTLLIKSATLAGAGIAVLLL
RMALRRDGARRQG