Protein Info for RR42_RS18200 in Cupriavidus basilensis FW507-4G11

Annotation: peptide ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 transmembrane" amino acids 31 to 52 (22 residues), see Phobius details amino acids 103 to 129 (27 residues), see Phobius details amino acids 142 to 180 (39 residues), see Phobius details amino acids 218 to 248 (31 residues), see Phobius details amino acids 270 to 291 (22 residues), see Phobius details PF12911: OppC_N" amino acids 17 to 59 (43 residues), 43.4 bits, see alignment 2.5e-15 PF00528: BPD_transp_1" amino acids 119 to 302 (184 residues), 118.7 bits, see alignment E=2.7e-38

Best Hits

Swiss-Prot: 42% identical to DPPC_ECO57: Dipeptide transport system permease protein DppC (dppC) from Escherichia coli O157:H7

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 91% identity to reh:H16_A3296)

MetaCyc: 42% identical to dipeptide ABC transporter membrane subunit DppC (Escherichia coli K-12 substr. MG1655)
ABC-8-RXN [EC: 7.4.2.9]

Predicted SEED Role

"Dipeptide transport system permease protein dppC"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YKA7 at UniProt or InterPro

Protein Sequence (305 amino acids)

>RR42_RS18200 peptide ABC transporter permease (Cupriavidus basilensis FW507-4G11)
MTTATETTAAPPLAEQTPLRRFASQFLSSKIAVTGLTLLIVILLIALLAPWLSPQNPYDL
ATLDVLDARMAPGEQSGSGMTFLLGSDEQGRDILSAVMYGLRISIGVGVVSTVIALLLGA
TLGLIAGFLGGRVEAIIMRVADLQLSFPPILLALILLAFLRPGIGNIVIALVAVQWAYYA
RTTRSAALVERRKEYIEAATCLGLPPGRIMFRHLLPNCLPPLIVIAALQVASAITLEATL
SFLGLGVPITEPSLGSLIANGQQYMLSGKYWISFFPGIALVVTIVAMNLVADQLRDVLNP
RLQTQ