Protein Info for RR42_RS18195 in Cupriavidus basilensis FW507-4G11

Annotation: methionine ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 PF00005: ABC_tran" amino acids 25 to 189 (165 residues), 102 bits, see alignment E=6.9e-33 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 238 to 322 (85 residues), 90 bits, see alignment E=4e-30 PF08352: oligo_HPY" amino acids 240 to 304 (65 residues), 72.5 bits, see alignment E=4.4e-24

Best Hits

Swiss-Prot: 49% identical to Y3317_BRUA2: Putative peptide import ATP-binding protein BAB2_0817 (BAB2_0817) from Brucella abortus (strain 2308)

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein (inferred from 92% identity to cti:RALTA_A2750)

Predicted SEED Role

"Oligopeptide transport ATP-binding protein oppD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YE71 at UniProt or InterPro

Protein Sequence (332 amino acids)

>RR42_RS18195 methionine ABC transporter ATP-binding protein (Cupriavidus basilensis FW507-4G11)
MSKPTLVVEGLKTQFFTRGGVARAVDDVSFSVGRGEIMGLVGESGSGKSMTGYSIMGLID
PPGKVVDGRIELTSRDGVTRDLRNLTPAQMRDVRGNRIAMIFQDPMMTLNPVLRIDTQMI
EAVLAHEKVDKAVARERSRNALARVGIPSPDERLRAYPHQFSGGMRQRVAIAIALLNKPD
LIIADEPTTALDVTIQGQILYEMQKLCRESGTALIWITHDLSVVAGLADTVCVMYAGKIV
EAGDVRQVLERPEHPYTHGLISSAPSRNPRGAPLRQIPGMTPSLLNLPAGCAFRERCTYA
TDVCKTAPPLDTAADGRRLRCFHPVLSQQEAA