Protein Info for RR42_RS17960 in Cupriavidus basilensis FW507-4G11

Annotation: octaprenyl diphosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 58% identical to ISPB_SHIFL: Octaprenyl diphosphate synthase (ispB) from Shigella flexneri

KEGG orthology group: K02523, octaprenyl-diphosphate synthase [EC: 2.5.1.90] (inferred from 94% identity to rme:Rmet_3107)

MetaCyc: 58% identical to all-trans-octaprenyl-diphosphate synthase (Escherichia coli K-12 substr. MG1655)
RXN-8992 [EC: 2.5.1.90]

Predicted SEED Role

No annotation

MetaCyc Pathways

superpathway of chorismate metabolism (45/59 steps found)
polyisoprenoid biosynthesis (E. coli) (5/5 steps found)
superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (10/12 steps found)
octaprenyl diphosphate biosynthesis (1/1 steps found)
superpathway of menaquinol-8 biosynthesis I (5/10 steps found)
superpathway of demethylmenaquinol-8 biosynthesis I (4/9 steps found)
superpathway of menaquinol-8 biosynthesis III (2/9 steps found)
superpathway of menaquinol-8 biosynthesis II (2/10 steps found)

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.90

Use Curated BLAST to search for 2.5.1.90

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y6G6 at UniProt or InterPro

Protein Sequence (325 amino acids)

>RR42_RS17960 octaprenyl diphosphate synthase (Cupriavidus basilensis FW507-4G11)
MSQSSATALLAPVAADMRAVDSVIRQRLASEVPLIEQIGEYIISAGGKRLRPVILLLSAR
AFGYDGNRHHELAAVVEFIHTATLLHDDVVDESELRRGRQTANAVFGNAASVLVGDFLYS
RAFQMMVDAGSMRIMEILSNATNVIAEGEVLQLLNMHDPDVTVERYLQVIRYKTAKLFEA
SAQLGAVLAGADAATEEAAAEYGRRIGTAFQLIDDMLDYTASAEQMGKNAGDDLREGKPT
LPLLHLLEHGTAEQRTLAREAIVQGGTEHFDAVFAAIHASGALEVTFQAAQREAEAAEIA
AQRFPDSPLKQTLIDLCAFSLQRQS