Protein Info for RR42_RS17895 in Cupriavidus basilensis FW507-4G11

Annotation: hypoxanthine phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 180 transmembrane" amino acids 42 to 64 (23 residues), see Phobius details PF00156: Pribosyltran" amino acids 15 to 165 (151 residues), 64.9 bits, see alignment E=2.9e-22

Best Hits

Swiss-Prot: 31% identical to HPRT_LACLA: Hypoxanthine-guanine phosphoribosyltransferase (hpt) from Lactococcus lactis subsp. lactis (strain IL1403)

KEGG orthology group: K00760, hypoxanthine phosphoribosyltransferase [EC: 2.4.2.8] (inferred from 88% identity to rsl:RPSI07_0695)

Predicted SEED Role

"Hypoxanthine-guanine phosphoribosyltransferase (EC 2.4.2.8)" in subsystem Purine conversions (EC 2.4.2.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y6E5 at UniProt or InterPro

Protein Sequence (180 amino acids)

>RR42_RS17895 hypoxanthine phosphoribosyltransferase (Cupriavidus basilensis FW507-4G11)
MMTAEQARELWANSEEIVSAEAVQASLDRMAGEITEKMGDTFPLVLSVMGGAVVFTGMLL
PKLAFPLEFDYIHLSRYNNKTVGGEMQWRVAPRESVKGRTVLVLDDILDEGETMAAIRQR
IMDMGATNVYAAVLCEKVLQKAKPMHPDFCGFTVPERYVFGCGMDAHGYWRNLPAIRALR