Protein Info for RR42_RS17895 in Cupriavidus basilensis FW507-4G11

Annotation: hypoxanthine phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00156: Pribosyltran
  • amino acids 15 to 165 (151 residues), 64.9 bits, E=2.9e-22

Best Hits

Swiss-Prot: 31% identical to HPRT_LACLA: Hypoxanthine-guanine phosphoribosyltransferase (hpt) from Lactococcus lactis subsp. lactis (strain IL1403)

KEGG orthology group: K00760, hypoxanthine phosphoribosyltransferase [EC: 2.4.2.8] (inferred from 88% identity to rsl:RPSI07_0695)

Predicted SEED Role

"Hypoxanthine-guanine phosphoribosyltransferase (EC 2.4.2.8)" in subsystem Purine conversions (EC 2.4.2.8)

MetaCyc Pathways

• superpathway of purine nucleotide salvage (12/14 steps found)
• adenine salvage (2/3 steps found)
• guanine and guanosine salvage I (1/2 steps found)
• guanine and guanosine salvage II (1/2 steps found)
• xanthine and xanthosine salvage (1/2 steps found)
• adenine and adenosine salvage III (2/4 steps found)
• superpathway of guanine and guanosine salvage (1/3 steps found)

KEGG Metabolic Maps

• Drug metabolism - other enzymes
• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.8

Sequence Analysis Tools

See A0A0C4Y6E5 at UniProt or InterPro

Protein Sequence (180 amino acids)

>RR42_RS17895 hypoxanthine phosphoribosyltransferase (Cupriavidus basilensis FW507-4G11)
MMTAEQARELWANSEEIVSAEAVQASLDRMAGEITEKMGDTFPLVLSVMGGAVVFTGMLL
PKLAFPLEFDYIHLSRYNNKTVGGEMQWRVAPRESVKGRTVLVLDDILDEGETMAAIRQR
IMDMGATNVYAAVLCEKVLQKAKPMHPDFCGFTVPERYVFGCGMDAHGYWRNLPAIRALR