Protein Info for RR42_RS17875 in Cupriavidus basilensis FW507-4G11

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 697 transmembrane" amino acids 33 to 54 (22 residues), see Phobius details amino acids 78 to 103 (26 residues), see Phobius details amino acids 111 to 129 (19 residues), see Phobius details amino acids 144 to 173 (30 residues), see Phobius details amino acids 185 to 206 (22 residues), see Phobius details amino acids 242 to 263 (22 residues), see Phobius details amino acids 337 to 354 (18 residues), see Phobius details PF00512: HisKA" amino acids 429 to 502 (74 residues), 50.1 bits, see alignment E=2.3e-17 PF02518: HATPase_c" amino acids 566 to 654 (89 residues), 52.7 bits, see alignment E=5.6e-18

Best Hits

KEGG orthology group: K02668, two-component system, NtrC family, sensor histidine kinase PilS [EC: 2.7.13.3] (inferred from 77% identity to cti:RALTA_A2689)

Predicted SEED Role

"Two-component sensor PilS" in subsystem Type IV pilus

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YDT0 at UniProt or InterPro

Protein Sequence (697 amino acids)

>RR42_RS17875 histidine kinase (Cupriavidus basilensis FW507-4G11)
MNGPASFWSRLNAWHALAAMWRQPEPPEFHWRLLRYFCWTRLAVAALLLGYAWLPAQRAE
AERAAQALATGLGSGFGSGLAALPLAVPYAVMALGMLVATLWWRRGFHLRVRFQVLADLA
LLGLIFHAQGQRGEGLAMIFLLPALQAGALTSLLFALFAAAVSALVVMSAPFAQTLLLRQ
ADTGLLGSGLYGLVFMIAASLMYLLANRQLAQERLALAREQELRLQQLVNRLMVNDMQDG
VMLLRANGVVVAANPAAVVLLGVQPAERGKHSETPANGRDALFDLRQIPRLQPLMEMLRD
WVRSKDDAPRILQLLPLPSRPSSGRGPILHTRLRLRFLLPGLASLRSTFASSMSVSLGAQ
NAMNTGTWNELSPEAAARLRLAIAQSEAMAWRPEDEALLRSEMRDTVLVHIESWERIAEQ
VQQEKLAAMGRLVASVAHQIRNPLAAISQASELLAETSRRAARPGEAGRAEGDVDARLLR
IIHDNVRRLDQVVSDVLQMSRRPRTERTTVDLNQALPEIVGRWRLEMRARSTSHDPVGAR
RVPRPAEINANAIRLTVDVARPVIFDASQLQQVLGNLLDNAWRYCSRLPGAIRLLAHALD
QHHAELIVWNDGVEVSREHQRTLFEPFFTSNAQGTGLGLFMARELCGANDAQVRYGTISI
DALLAQTGMLAPATRDTLPAKAFVLTLRIEAPDSAGG