Protein Info for RR42_RS17775 in Cupriavidus basilensis FW507-4G11

Annotation: Fe(II)-dependent oxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13640: 2OG-FeII_Oxy_3
  • amino acids 85 to 179 (95 residues), 55.9 bits, E=6.8e-19
• PF18331: PKHD_C
  • amino acids 185 to 227 (43 residues), 68.7 bits, 3.5e-23

Best Hits

Swiss-Prot: 84% identical to Y2877_CUPNJ: PKHD-type hydroxylase Reut_A2877 (Reut_A2877) from Cupriavidus necator (strain JMP 134 / LMG 1197)

KEGG orthology group: K07336, PKHD-type hydroxylase [EC: 1.14.11.-] (inferred from 84% identity to reu:Reut_A2877)

Predicted SEED Role

"Iron-uptake factor PiuC" in subsystem Transport of Iron

KEGG Metabolic Maps

• Benzoxazinone biosynthesis
• Diterpenoid biosynthesis
• Glycine, serine and threonine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.14.11.-

Use Curated BLAST to search for 1.14.11.-

Sequence Analysis Tools

See A0A0C4YDP7 at UniProt or InterPro

Protein Sequence (228 amino acids)

>RR42_RS17775 Fe(II)-dependent oxygenase (Cupriavidus basilensis FW507-4G11)
MLVCIPKVLNAEQLAVLRQHLDQAGTAWVDGRVSAGYSGAPVKFNQQIDERAEVAQQCQH
LILGMLERNPLFISAALPNIVYPPMFNRYSEGMTFGAHVDGSVRIHPHNGRKLRTDVSAT
LFLSDPASYDGGELQVEDTYGTHSVKLEAGDMVIYPATSLHQVTPITRGTRVASFFWIQS
LVRDDAQRALLFDLDNAIQKLNQTGADDGARRSLVGCYHNLLRQWTET