Protein Info for RR42_RS17720 in Cupriavidus basilensis FW507-4G11

Annotation: sugar kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00294: PfkB
  • amino acids 32 to 297 (266 residues), 143.8 bits, E=3.7e-46

Best Hits

Swiss-Prot: 33% identical to ADOK_MYCTU: Adenosine kinase (adoK) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K00856, adenosine kinase [EC: 2.7.1.20] (inferred from 84% identity to cti:RALTA_A2651)

Predicted SEED Role

"Sugar kinases, ribokinase family"

MetaCyc Pathways

• superpathway of purine nucleotide salvage (12/14 steps found)
• adenine and adenosine salvage VI (1/1 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.20

Sequence Analysis Tools

See A0A0C4Y6A9 at UniProt or InterPro

Protein Sequence (315 amino acids)

>RR42_RS17720 sugar kinase (Cupriavidus basilensis FW507-4G11)
MSSLICGSVAYDTIMTFEGHFREHILPDQIHMLNVSFLVPSMRREFGGCAGNIAYTLKLL
GGDPLVMATVGVDAEPYLQHLRALDISTEHIRTLPDTFTAQAMITTDLENNQITAFHPGA
MNQSQLSQVQDALGGSNAPGLGIVAPDSREGMLHHARQFADAGVPFIFDLGQAMPLFNGD
DLRQFVELASYVTVNDYEAQVLLSRTGWTSDEVAAQVKAFIVTHGEKGATVFADKQKYNI
ASVKADRVVDPTGCGDAFRGGLLYGIEQGFDWETTGRLASLMGSIKIAHQGPQNHKPSRD
EIGERFQSAFGYRYE