Protein Info for RR42_RS17705 in Cupriavidus basilensis FW507-4G11

Annotation: ribosomal protein L11 methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF06325: PrmA
  • amino acids 3 to 296 (294 residues), 331.4 bits, E=2.2e-102
• TIGR00406: ribosomal protein L11 methyltransferase
  • amino acids 5 to 290 (286 residues), 230.2 bits, E=1.7e-72
• PF05175: MTS
  • amino acids 151 to 234 (84 residues), 41.6 bits, E=4.2e-14
• PF01135: PCMT
  • amino acids 153 to 214 (62 residues), 24.1 bits, E=1.2e-08
• PF13489: Methyltransf_23
  • amino acids 154 to 292 (139 residues), 47.6 bits, E=6.1e-16
• PF02475: Met_10
  • amino acids 161 to 217 (57 residues), 23.3 bits, E=2e-08
• PF13847: Methyltransf_31
  • amino acids 163 to 260 (98 residues), 44.7 bits, E=5e-15
• PF13649: Methyltransf_25
  • amino acids 169 to 255 (87 residues), 34.6 bits, E=1e-11
• PF08241: Methyltransf_11
  • amino acids 170 to 258 (89 residues), 32.7 bits, E=3.8e-11

Best Hits

Swiss-Prot: 92% identical to PRMA_CUPNH: Ribosomal protein L11 methyltransferase (prmA) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K02687, ribosomal protein L11 methyltransferase [EC: 2.1.1.-] (inferred from 92% identity to reh:H16_A3173)

Predicted SEED Role

"Ribosomal protein L11 methyltransferase (EC 2.1.1.-)" in subsystem Heat shock dnaK gene cluster extended or Ribosome biogenesis bacterial (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

See A0A0C4YG53 at UniProt or InterPro

Protein Sequence (304 amino acids)

>RR42_RS17705 ribosomal protein L11 methyltransferase (Cupriavidus basilensis FW507-4G11)
MAFQECVIEIAQDQAEAWSDALFDLGALSVSVEDADADTPDEQPLFGEPGMEPTRLAWNR
SRVVALFDDSADPVLVVAAAANALGVDPVPAYQLRPVEDQDWVRLTQSQFAPIRIGERIW
VVPSWHDAPDPDAVVLELDPGLAFGTGSHPTTRLCMQWLEQNIKAGETVLDYGCGSGILA
IVARKLGAGDTLGIDIDPNAVEASRYNAERNRVEATFALPETVSEASYDLVVANILSNPL
KLMAAMLSARVRPGGRLVLSGVLERQADEVAAAYAPWLPMSVWRSEEGWVCLHGTRGEGP
GTQR