Protein Info for RR42_RS17675 in Cupriavidus basilensis FW507-4G11

Annotation: UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl- meso-diaminopimelate ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF01225: Mur_ligase" amino acids 2 to 100 (99 residues), 79.9 bits, see alignment E=2.3e-26 TIGR01081: UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase" amino acids 2 to 459 (458 residues), 709.6 bits, see alignment E=9e-218 PF08245: Mur_ligase_M" amino acids 108 to 298 (191 residues), 79.1 bits, see alignment E=6.8e-26 PF02875: Mur_ligase_C" amino acids 320 to 446 (127 residues), 72.5 bits, see alignment E=8.7e-24

Best Hits

KEGG orthology group: K02558, UDP-N-acetylmuramate: L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase [EC: 6.3.2.-] (inferred from 87% identity to reh:H16_A3167)

MetaCyc: 64% identical to UDP-N-acetylmuramate--L-alanyl-gamma-D-glutamyl-meso-2,6-diaminoheptandioate ligase (Pseudomonas aeruginosa PAO1)
RXN0-2361 [EC: 6.3.2.45]

Predicted SEED Role

"UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase (EC 6.3.2.-)" (EC 6.3.2.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.2.-

Use Curated BLAST to search for 6.3.2.- or 6.3.2.45

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YDL5 at UniProt or InterPro

Protein Sequence (465 amino acids)

>RR42_RS17675 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl- meso-diaminopimelate ligase (Cupriavidus basilensis FW507-4G11)
MHIHILGICGTFMGGLAVLAKQAGHRVTGCDANVYPPMSTQLEAQGIELIEGFDPGQLAL
EPDLFVIGNVVSRGNPLMEAILNRNLPYVSGPQWLGEHVLRGKWTLAVAGTHGKTTTTSM
LAWILEDAGYQPGFLVGGVPQNFGVSARVTESDFFVIEADEYDTAFFDKRSKFVHYRPRT
AILNNLEYDHADIFPDLAAIETQFHHLVRTVPEQGRLIVNGFEESLARVLERGCWSETEQ
FGIGDWRAGEPAEGNAIGDGMTQDSFDVWFGDVLQGRLSWALQGTHNRMNALAAIAAARH
VGVPAPQAIDSLSRFANVKRRMEVRGVVNGITVYDDFAHHPTAIQTTLEGLRKRVGAARI
LAVLEPRSNTMKLGVMKAQLPASLEAADLVFGYGAASGKDALGWDLAESLAPLGERAAAF
SDLPELVRAVRAAARPGDHVLVMSNGGFGGVHQKLLDAFAAGACA