Protein Info for RR42_RS17490 in Cupriavidus basilensis FW507-4G11

Annotation: NADP transhydrogenase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 PF05222: AlaDh_PNT_N" amino acids 4 to 136 (133 residues), 139.7 bits, see alignment E=7.1e-45 PF01262: AlaDh_PNT_C" amino acids 140 to 369 (230 residues), 235.9 bits, see alignment E=3.4e-74

Best Hits

KEGG orthology group: K00324, NAD(P) transhydrogenase subunit alpha [EC: 1.6.1.2] (inferred from 91% identity to reu:Reut_A2823)

Predicted SEED Role

"NAD(P) transhydrogenase alpha subunit (EC 1.6.1.2)" in subsystem Phosphate metabolism (EC 1.6.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.1.2

Use Curated BLAST to search for 1.6.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YJQ7 at UniProt or InterPro

Protein Sequence (373 amino acids)

>RR42_RS17490 NADP transhydrogenase subunit alpha (Cupriavidus basilensis FW507-4G11)
MHIGIPQETRAGETRVAATPETVKKYVTQGHQVIVQSGAGVRASVPDSAYEAVGATIGTA
AQAFGTQLVLKVRAPVDAELALMKPGAVLVGMLNPFDAENNARMASATLTAFALEAAPRT
TRAQSMDVLSSQANIAGYKAVLVAAHHYQRFMPMLMTAAGTVKAARVLILGAGVAGLQAI
ATAKRLGAVIEASDVRPAVKEQIESLGAKFLDVPFVTDEEREIAQGVGGYARPMPPDWMR
RQAELVHERAKAADIVITTALIPGRQAPVLLKEETVQAMKPGSVVVDLAAAQGGNCPLTV
ADEVVERHGVTLIGHTNLASMVAADASALYARNVLDFLKLVIDKEGQFTLNLEDDIVAAC
LMCKDGQVVRGAS