Protein Info for RR42_RS17465 in Cupriavidus basilensis FW507-4G11

Annotation: tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 PF02540: NAD_synthase" amino acids 4 to 46 (43 residues), 22.5 bits, see alignment 1.1e-08 TIGR00420: tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase" amino acids 5 to 365 (361 residues), 419.8 bits, see alignment E=3.7e-130 PF03054: tRNA_Me_trans" amino acids 5 to 207 (203 residues), 265 bits, see alignment E=8.7e-83 PF20259: tRNA_Me_trans_M" amino acids 212 to 280 (69 residues), 73.9 bits, see alignment E=1.2e-24 PF20258: tRNA_Me_trans_C" amino acids 292 to 365 (74 residues), 72.6 bits, see alignment E=5.3e-24

Best Hits

Swiss-Prot: 90% identical to MNMA_RALSO: tRNA-specific 2-thiouridylase MnmA (mnmA) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K00566, tRNA-specific 2-thiouridylase [EC: 2.8.1.-] (inferred from 90% identity to rso:RSc2723)

MetaCyc: 58% identical to tRNA-specific 2-thiouridylase (Escherichia coli K-12 substr. MG1655)
RXN0-2023 [EC: 2.8.1.13]

Predicted SEED Role

"tRNA-specific 2-thiouridylase MnmA"

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.-

Use Curated BLAST to search for 2.8.1.- or 2.8.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YJQ0 at UniProt or InterPro

Protein Sequence (366 amino acids)

>RR42_RS17465 tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase (Cupriavidus basilensis FW507-4G11)
MSQGKRVVVGMSGGVDSSVTAWLLKQQGYEVIGLFMKNWEDDDDSEYCSTRQDWLDVVSV
ADLIGVDVEAVNFAAEYKDRVFADFLREYSAGRTPNPDVLCNAEIKFKAFLDHAMSLGAD
TIATGHYARVREAGADVGAGTGRFELLKAFDHTKDQSYFLHRLNQAQLSRTLFPLGEMPK
TRVREIAAEIGLPNARKKDSTGICFIGERPFRDFLNRYLPTKPGPMRTPDGKEVGQHIGL
AFYTLGQRKGIGLGGSRAGNGDAWYVARKDMASNTLYVVQGHEHPWLLTPTLDAADLSWV
AGTGPAAGATLSAKTRYRQSDAPCTVTGAGDDALQLTFTQAQWAVTPGQSAVLYDGDVCL
GGGIIR