Protein Info for RR42_RS17425 in Cupriavidus basilensis FW507-4G11

Annotation: chemotaxis protein CheY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 PF00072: Response_reg" amino acids 11 to 122 (112 residues), 55.5 bits, see alignment E=8.9e-19 PF00512: HisKA" amino acids 143 to 209 (67 residues), 31 bits, see alignment E=3.1e-11 PF02518: HATPase_c" amino acids 266 to 367 (102 residues), 61.6 bits, see alignment E=1.4e-20

Best Hits

KEGG orthology group: None (inferred from 76% identity to rme:Rmet_2950)

Predicted SEED Role

"FOG: CheY-like receiver"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YDE1 at UniProt or InterPro

Protein Sequence (377 amino acids)

>RR42_RS17425 chemotaxis protein CheY (Cupriavidus basilensis FW507-4G11)
MSDARQPRLTVLYVDDEEMACKYFARAVGTEYEVLVASSADEAVRILRRESARIAVLVTD
FRMPGRDGGDLLRQVALEYPQIVRILVTAYADKDMLLRTVNTGEVFRILEKPIELGQVRE
ALRLAAERYRERSIRHQRLMAIDETLAFLAHELNTPLAAIANFARGIESRVAAQYNPLRQ
SEIGQAATSMHDNAQYCLAVISSFLQSVRSSGSRPSTQAGASREVTAGGLIAALLDTYPF
AGPQREWIKIEMHDDFAVRTLPNCVALVLSSLLSNALRALDGVDSPSLRFVVAAEPDAAI
RICDNGPGIPPEVMGRLLVDPVTTHASTGGNGLGMIFCNRVMQSFGGGIRIESTSGAGTT
VTLDFPNTKSRMHRSDR