Protein Info for RR42_RS17270 in Cupriavidus basilensis FW507-4G11

Annotation: molecular chaperone DnaJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 PF00226: DnaJ" amino acids 5 to 67 (63 residues), 99.3 bits, see alignment E=1.6e-32 TIGR02349: chaperone protein DnaJ" amino acids 5 to 358 (354 residues), 446.5 bits, see alignment E=4.2e-138 PF01556: DnaJ_C" amino acids 129 to 342 (214 residues), 178.8 bits, see alignment E=1.1e-56 PF00684: DnaJ_CXXCXGXG" amino acids 156 to 216 (61 residues), 65.8 bits, see alignment E=5.3e-22

Best Hits

Swiss-Prot: 93% identical to DNAJ_CUPNJ: Chaperone protein DnaJ (dnaJ) from Cupriavidus necator (strain JMP 134 / LMG 1197)

KEGG orthology group: K03686, molecular chaperone DnaJ (inferred from 93% identity to reu:Reut_A2784)

MetaCyc: 56% identical to chaperone protein DnaJ (Escherichia coli K-12 substr. MG1655)
1.8.4.-

Predicted SEED Role

"Chaperone protein DnaJ" in subsystem Heat shock dnaK gene cluster extended or Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YJK7 at UniProt or InterPro

Protein Sequence (383 amino acids)

>RR42_RS17270 molecular chaperone DnaJ (Cupriavidus basilensis FW507-4G11)
MAKRDFYEVLGVGKNAGDDEIKKAYRKLAMKHHPDRNPDSKDSEEKFKEVKEAYEMLSDP
EKKAAYDQYGHAGVDPNMAGGFGGGGQAYGGFAEAFGDIFGDIFGQQGGQAGGGRRGGGG
PQVYRGADLRYSMEITLEQAAHGHDAQIRVPHWDECEHCHGNGAEPGTNVETCPTCHGAG
QVRVSQGFFSMQQTCPKCHGTGKHIPKPCTKCHGQGKLKSQKTLEVKIPAGIDEGMRIRS
SGNGEPGINGGPPGDLYVEVHIKQHAVFERDGDDLHCQMPISFATAALGGDLEVPTLGGK
ASFPVPEGTQPGKTFRLRGKGIKGVRSGYPGDLYVHVNVETPVKLTEAQKDILRQFDRSV
HEGGSRHSPQEQSWLDKVKSFFS