Protein Info for RR42_RS17240 in Cupriavidus basilensis FW507-4G11

Annotation: 2-amino-4-hydroxy-6- hydroxymethyldihydropteridine pyrophosphokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01498: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
  • amino acids 4 to 131 (128 residues), 124.5 bits, E=1.5e-40
• PF01288: HPPK
  • amino acids 5 to 131 (127 residues), 124.6 bits, E=1.4e-40

Best Hits

Swiss-Prot: 39% identical to HPPK_STRP6: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (folK) from Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)

KEGG orthology group: K00950, 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC: 2.7.6.3] (inferred from 84% identity to reh:H16_A3082)

Predicted SEED Role

"2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC 2.7.6.3)" in subsystem Folate Biosynthesis (EC 2.7.6.3)

MetaCyc Pathways

• superpathway of chorismate metabolism (45/59 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (11/12 steps found)
• superpathway of tetrahydrofolate biosynthesis (9/10 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis I (4/5 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis IV (Plasmodium) (2/3 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis III (Chlamydia) (3/5 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis V (Pyrococcus) (1/4 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis II (Methanocaldococcus) (2/7 steps found)
• tetrahydromethanopterin biosynthesis (3/14 steps found)

KEGG Metabolic Maps

• Folate biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.6.3

Sequence Analysis Tools

See A0A0C4YDL7 at UniProt or InterPro

Protein Sequence (172 amino acids)

>RR42_RS17240 2-amino-4-hydroxy-6- hydroxymethyldihydropteridine pyrophosphokinase (Cupriavidus basilensis FW507-4G11)
MTLAFIGIGANLGDARQALKDAIVCLAQQVGITVLARSSLYRTAPVDAAGNDYYNAVVKV
ETSFTAAQLLRICHHIEDQFGRERPFRNAPRTLDLDLLVFGDEIHQGEKLVVPHPRLAER
AFTLVPLLELDAELVIPGLGPAADYLAAVSAQRVEKVSFCKCTRQLDARSDS