Protein Info for RR42_RS17215 in Cupriavidus basilensis FW507-4G11

Annotation: GCN5 family acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 167 PF00583: Acetyltransf_1" amino acids 52 to 143 (92 residues), 68.3 bits, see alignment E=1.4e-22 PF13508: Acetyltransf_7" amino acids 68 to 143 (76 residues), 41.4 bits, see alignment E=3e-14 PF08445: FR47" amino acids 83 to 146 (64 residues), 26.8 bits, see alignment E=8.3e-10

Best Hits

Swiss-Prot: 38% identical to SAT2_BOVIN: Diamine acetyltransferase 2 (SAT2) from Bos taurus

KEGG orthology group: K00680, [EC: 2.3.1.-] (inferred from 83% identity to reh:H16_A3071)

Predicted SEED Role

"Histone acetyltransferase HPA2 and related acetyltransferases"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YFW1 at UniProt or InterPro

Protein Sequence (167 amino acids)

>RR42_RS17215 GCN5 family acetyltransferase (Cupriavidus basilensis FW507-4G11)
MPATDFVLRPATSDDCETLLALITGLAEYEKLTHLVEATPEKLREALFGPRPHAEAVLVE
VPGTQGPQAVGFALFFHNFSTFLAKPGLYLEDLYVDPAWRGHGLGKVLLKHLAALAVERG
CGRFEWSVLDWNTPSIDFYRAMGADVMPDWRICRVTGDALAKLGATE