Protein Info for RR42_RS17210 in Cupriavidus basilensis FW507-4G11

Annotation: tRNA delta(2)-isopentenylpyrophosphate transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 TIGR00174: tRNA dimethylallyltransferase" amino acids 19 to 305 (287 residues), 296.9 bits, see alignment E=7.2e-93 PF01745: IPT" amino acids 20 to 72 (53 residues), 29.7 bits, see alignment 6.4e-11 PF01715: IPPT" amino acids 53 to 301 (249 residues), 294.2 bits, see alignment E=1.4e-91

Best Hits

Swiss-Prot: 87% identical to MIAA_CUPNJ: tRNA dimethylallyltransferase (miaA) from Cupriavidus necator (strain JMP 134 / LMG 1197)

KEGG orthology group: K00791, tRNA dimethylallyltransferase [EC: 2.5.1.75] (inferred from 87% identity to reu:Reut_A2770)

Predicted SEED Role

"tRNA dimethylallyltransferase (EC 2.5.1.75)" (EC 2.5.1.75)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.75

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YD92 at UniProt or InterPro

Protein Sequence (328 amino acids)

>RR42_RS17210 tRNA delta(2)-isopentenylpyrophosphate transferase (Cupriavidus basilensis FW507-4G11)
MTTASPSGTAAPASGHAPVVCLLGPTASGKTAAALALAAQTPIEIISLDSALVYREMDIG
TAKPSPTELTAVPHHLIDIIDPADSYSAAQFVTDAERLIVEIRARGREPLIVGGTMLYYK
ALTQGLNDLPQADPALRAELDALAAERGWPALHAMLGEVDPVTAARLAPNDAQRIQRALE
IHRLSGHPMSALLARQADERTFAGAADLRYRVIALEPSDRAVLHARIATRYDAMLAGGFI
EEVQRLRARGDLQPALPSIRCVGYRQVWEYLDGETDFDTMRERGLAATRQLCKRQLTWLR
STPEREVVDCLAPDYVAQVARLARIGQA