Protein Info for RR42_RS17105 in Cupriavidus basilensis FW507-4G11

Annotation: Clp protease ClpX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 764 TIGR02639: ATP-dependent Clp protease ATP-binding subunit ClpA" amino acids 3 to 735 (733 residues), 1106.6 bits, see alignment E=0 PF02861: Clp_N" amino acids 13 to 62 (50 residues), 55.2 bits, see alignment 4.2e-18 PF00004: AAA" amino acids 212 to 344 (133 residues), 47.5 bits, see alignment E=1.6e-15 amino acids 493 to 617 (125 residues), 48.3 bits, see alignment E=9.6e-16 PF17871: AAA_lid_9" amino acids 351 to 452 (102 residues), 94.2 bits, see alignment E=2.7e-30 PF07724: AAA_2" amino acids 487 to 648 (162 residues), 200.5 bits, see alignment E=1.3e-62 PF00158: Sigma54_activat" amino acids 491 to 613 (123 residues), 21.4 bits, see alignment E=1.2e-07 PF07728: AAA_5" amino acids 492 to 610 (119 residues), 52.3 bits, see alignment E=4e-17 PF10431: ClpB_D2-small" amino acids 654 to 734 (81 residues), 83.4 bits, see alignment E=6e-27

Best Hits

Swiss-Prot: 61% identical to CLPA_RHOBL: ClpA homolog protein from Rhodobacter blasticus

KEGG orthology group: K03694, ATP-dependent Clp protease ATP-binding subunit ClpA (inferred from 86% identity to bmv:BMASAVP1_A0576)

Predicted SEED Role

"ATP-dependent Clp protease ATP-binding subunit ClpA" in subsystem Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YFU6 at UniProt or InterPro

Protein Sequence (764 amino acids)

>RR42_RS17105 Clp protease ClpX (Cupriavidus basilensis FW507-4G11)
MIAQELEVSLHMAFVEARQARHEFITVEHLLLALLDNPTAAEVLRACAANIEDLRTSLKN
FIADNTPVVPGTDEVDTQPTLGFQRVIQRAIMHVQSTSNGKKEVTGANVLVAIFGEKDSH
AVYYLQQQGVTRLDVVNFISHGIRKDQAEPAKHGDGTAEGEGGDGKESPLEQFTQNLNTL
AKAGKIDPLIGRESEVERVVQVLCRRRKNNPLLVGEAGVGKTAIAEGLAWRITKNEVPDI
LEKAVVYSLDMGALLAGTKYRGDFEQRLKGVLKSLKDNPNAILFIDEIHTLIGAGAASGG
TLDASNLLKPALSSGQLKCIGATTFTEYRGIFEKDAALSRRFQKIDVVEPSVDQTVQILR
GLKSRFEEHHGVKYAAAALTAAAELSARFITDRHLPDKAIDVIDEAGAAQRILPKSKQKK
TIGKGEIEDIVSRIARIPPQSVNQDDRSKLQTLDRDLKSVVFGQEPAIEALASAIKMSRA
GLGKTDKPIGSFLFSGPTGVGKTEVAKQLAFIMGIELLRFDMSEYMERHAVSRLIGAPPG
YVGFDQGGLLTEAVTKKPHCVLLLDEIEKAHPDIFNILLQVMDHGALTDNNGRRADFRNV
IIIMTTNAGAETMNRATIGFTSSREQGDEMVDIKRMFTPEFRNRLDAIISFRSLDEEIIL
RVVDKFLMQLEEQLHEKKVEASFSDHLRKFLAKKGFDPLMGARPMQRLIQDLIRKALADE
LLFGKLVSGGRVVVDLDEQDQIKLDFAEAAAEPPEAPENEKAEV