Protein Info for RR42_RS16865 in Cupriavidus basilensis FW507-4G11

Annotation: general secretion pathway protein GspH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 15 to 38 (24 residues), 32 bits, see alignment 3.7e-12 PF07963: N_methyl" amino acids 15 to 37 (23 residues), 30.5 bits, see alignment 1.9e-11 PF12019: GspH" amino acids 53 to 152 (100 residues), 47.9 bits, see alignment E=1.7e-16

Best Hits

KEGG orthology group: None (inferred from 63% identity to reu:Reut_A0400)

Predicted SEED Role

"Type IV fimbrial biogenesis protein FimT" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YFP1 at UniProt or InterPro

Protein Sequence (162 amino acids)

>RR42_RS16865 general secretion pathway protein GspH (Cupriavidus basilensis FW507-4G11)
MRNFTAWRAAGLLPKRGFTLIELLATLTILAIIAFAAAPSFSSMVATQRARNAALDLSAA
VSLTRSEAVKRNSTITMAASSAWASGWSVTAGTEKVRSFGPYDGIAITASAGNSLAIGND
GRPATGSLTFQVAPSVSPQPASTICVQVSGTGRIAVVSGACT