Protein Info for RR42_RS16725 in Cupriavidus basilensis FW507-4G11

Annotation: fatty acid hydroxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 40 to 67 (28 residues), see Phobius details amino acids 79 to 97 (19 residues), see Phobius details amino acids 125 to 147 (23 residues), see Phobius details amino acids 153 to 173 (21 residues), see Phobius details PF04116: FA_hydroxylase" amino acids 85 to 217 (133 residues), 106.7 bits, see alignment E=6.1e-35

Best Hits

KEGG orthology group: None (inferred from 58% identity to cti:RALTA_B2063)

Predicted SEED Role

"Sterol desaturase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YDA9 at UniProt or InterPro

Protein Sequence (299 amino acids)

>RR42_RS16725 fatty acid hydroxylase (Cupriavidus basilensis FW507-4G11)
MNAFEKFQLFIAAPSVLAFALIEAIVLSRRQRYDWRAFGVSALDLVARIAVGIALPLSIA
APLVRLAFEHRWMTIHPTGWIALPLLFVGQEFCYYWYHRAAHRVRWFWSNHAVHHSPNQL
NLSAAFRIGVLGKLTGTALFFVPLAWIGFEPRVVFAVLSLNLLYQFWIHATWIPRLGWLE
GIFNTPSAHRVHHASNLEYLDANYGGVLVVFDRLFGTYVREREDLPCRYGLVHPIESANP
LRIEFTQWVHLLRDLAGARSLRAFLGYLLMPPGWTPHGEGSTTMELRAQAGMSGGVGDG