Protein Info for RR42_RS16720 in Cupriavidus basilensis FW507-4G11

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 41 to 61 (21 residues), see Phobius details amino acids 67 to 87 (21 residues), see Phobius details amino acids 99 to 120 (22 residues), see Phobius details amino acids 132 to 154 (23 residues), see Phobius details PF20327: DUF6622" amino acids 1 to 164 (164 residues), 80.2 bits, see alignment E=8.3e-27

Best Hits

KEGG orthology group: None (inferred from 39% identity to adn:Alide_3064)

Predicted SEED Role

"Na+/H+ antiporter" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YFL7 at UniProt or InterPro

Protein Sequence (173 amino acids)

>RR42_RS16720 hypothetical protein (Cupriavidus basilensis FW507-4G11)
MLTGILLHTPRWVWILLASLIALGFAQAVPRRMTPARATAVPVAMAVVSLGGVMSTFSAF
SAQPLALLGWGVGAAAALALAHTVGAWNGIRWLEADRRLLVPASWVPLSLILCLFITRYG
VSVAMAVNPGLLWHAGVAMPIGFIYGAVSGIFLSRSLVTWRLTRQAMLDSVPG