Protein Info for RR42_RS16255 in Cupriavidus basilensis FW507-4G11

Annotation: sulfate adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 62% identical to CYSD_MYCVP: Sulfate adenylyltransferase subunit 2 (cysD) from Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1)

KEGG orthology group: K00957, sulfate adenylyltransferase subunit 2 [EC: 2.7.7.4] (inferred from 93% identity to rme:Rmet_2813)

MetaCyc: 67% identical to sulfate adenylyltransferase small subunit (Allochromatium vinosum)
Sulfate adenylyltransferase. [EC: 2.7.7.4]

Predicted SEED Role

"Sulfate adenylyltransferase subunit 2 (EC 2.7.7.4)" in subsystem Cysteine Biosynthesis (EC 2.7.7.4)

MetaCyc Pathways

superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
assimilatory sulfate reduction I (4/4 steps found)
assimilatory sulfate reduction III (3/3 steps found)
sulfate activation for sulfonation (2/2 steps found)
assimilatory sulfate reduction IV (3/4 steps found)
superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (7/10 steps found)
assimilatory sulfate reduction II (1/3 steps found)
sulfite oxidation III (1/3 steps found)
selenate reduction (2/5 steps found)
superpathway of sulfur metabolism (Desulfocapsa sulfoexigens) (2/6 steps found)
dissimilatory sulfate reduction I (to hydrogen sufide)) (1/5 steps found)
superpathway of thiosulfate metabolism (Desulfovibrio sulfodismutans) (1/6 steps found)
superpathway of sulfide oxidation (phototrophic sulfur bacteria) (3/12 steps found)
superpathway of seleno-compound metabolism (6/19 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.4

Use Curated BLAST to search for 2.7.7.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YD41 at UniProt or InterPro

Protein Sequence (320 amino acids)

>RR42_RS16255 sulfate adenylyltransferase (Cupriavidus basilensis FW507-4G11)
MGIMNELTGAPEVAHLLQVQNDHLDKLEAESIYIIREVVAECRNPALLFSGGKDSIVMLH
LALKAFRLGDRKTELPFPLVHIDTGHNYPEVITFRDQRVAELGARLVVGHVEDSIKRGTV
RLRKETDSRNAAQAVTLLETIEANKYDALMGGARRDEEKARAKERIFSFRDEFGQWDPKA
QRPELWSLYNARMAAGEQMRVFPISNWTELDVWQYIAREELELPPIYYAHQREVVKKNGL
LVPVTPITPKQDGDVSEVLSVRFRTVGDISCTCPVASVAASPIEIIAETAVTEITERGAT
RMDDQTSEASMERRKKEGYF