Protein Info for RR42_RS16235 in Cupriavidus basilensis FW507-4G11

Annotation: permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 42 to 59 (18 residues), see Phobius details amino acids 63 to 83 (21 residues), see Phobius details amino acids 102 to 124 (23 residues), see Phobius details amino acids 301 to 320 (20 residues), see Phobius details amino acids 327 to 349 (23 residues), see Phobius details amino acids 359 to 381 (23 residues), see Phobius details TIGR04408: LPS export ABC transporter permease LptG" amino acids 7 to 380 (374 residues), 338.9 bits, see alignment E=1.3e-105 PF03739: LptF_LptG" amino acids 9 to 376 (368 residues), 260.3 bits, see alignment E=1.3e-81

Best Hits

KEGG orthology group: K11720, lipopolysaccharide export system permease protein (inferred from 86% identity to rme:Rmet_2809)

Predicted SEED Role

"FIG000906: Predicted Permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YJ35 at UniProt or InterPro

Protein Sequence (384 amino acids)

>RR42_RS16235 permease (Cupriavidus basilensis FW507-4G11)
MKVLRVYERYFARLIYGVFAFILFAVLALFVFFDMLSELESVAGRYTSLVAFFHVILQAP
TRIYEVLPIAVLISAIYVFSQLASQSEYTIFRVAGLNTRQALFSLFKLAIPLAIATFIFG
EFIGPKAEQYAQKVKLEALGATVSAGFRSGVWVKDRDRDASMGHEVTRFVNVAGLRPDQS
ITGVTIYEFDDQYRLSVIRVAKEGRYEGGQSWQLTGVTETHFLELPRGKPGQADALAPAF
RGEQQSVPTMAMRSELTPQILSVLLVEPERMSTVDLFRYIRHLRDNKQDTQRYEIAFWKK
VIYPLTLFVMVALALPFAYLHARAGAVGVKVFGGIMLGLSFHLSNTLFSHVGLLHTWPPI
VSALIPGTLYLLVALGALRWVDRH