Protein Info for RR42_RS16085 in Cupriavidus basilensis FW507-4G11

Annotation: cobalamin biosynthesis protein CobD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 68 to 88 (21 residues), see Phobius details amino acids 95 to 115 (21 residues), see Phobius details amino acids 169 to 190 (22 residues), see Phobius details amino acids 308 to 326 (19 residues), see Phobius details PF03186: CobD_Cbib" amino acids 20 to 304 (285 residues), 303.2 bits, see alignment E=8.5e-95 TIGR00380: cobalamin biosynthesis protein CobD" amino acids 21 to 284 (264 residues), 183.2 bits, see alignment E=3.5e-58

Best Hits

Swiss-Prot: 40% identical to COBD_CHLTE: Cobalamin biosynthesis protein CobD (cobD) from Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)

KEGG orthology group: K02227, adenosylcobinamide-phosphate synthase CobD [EC: 6.3.1.10] (inferred from 80% identity to reu:Reut_A0663)

Predicted SEED Role

"Adenosylcobinamide-phosphate synthase (EC 6.3.1.10)" (EC 6.3.1.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.1.10

Use Curated BLAST to search for 6.3.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YD13 at UniProt or InterPro

Protein Sequence (327 amino acids)

>RR42_RS16085 cobalamin biosynthesis protein CobD (Cupriavidus basilensis FW507-4G11)
MSSWWPFPLFSWQACVAAAAAGVLLDQWLGEPRRWHPLVGFGRLAAALERRLNRGQAGAP
LRQRLTGLAAWALMVLVPAALAALLVHAAAQFSTALAWLLQALALYAALGARSLAQHIAP
IATALTQGNLADARQLTARIVSRDTTDADTEALARAACESALENGNDAIFGALFWFLVGG
APAVVAYRLANTLDAMWGYRTPRLLYFGWAAARLDDVLNLAPARLTALSYALLGRTAQAL
RCWRAQAPAWSSPNAGPVMAAGAGAVGVALGGPARYHGEWEERPPLGMGHAPGAADVHAC
LRLVQRTLWLWLAASGASAALLHYGLA