Protein Info for RR42_RS15865 in Cupriavidus basilensis FW507-4G11

Annotation: uracil phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00156: Pribosyltran
  • amino acids 22 to 136 (115 residues), 56 bits, E=3e-19
• PF14681: UPRTase
  • amino acids 74 to 127 (54 residues), 27.2 bits, E=2.6e-10

Best Hits

Swiss-Prot: 63% identical to PYRR_RALSO: Bifunctional protein PyrR (pyrR) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K02825, pyrimidine operon attenuation protein / uracil phosphoribosyltransferase [EC: 2.4.2.9] (inferred from 81% identity to rme:Rmet_2741)

Predicted SEED Role

"Uracil phosphoribosyltransferase (EC 2.4.2.9) / Pyrimidine operon regulatory protein PyrR" in subsystem De Novo Pyrimidine Synthesis or LMPTP YwlE cluster (EC 2.4.2.9)

MetaCyc Pathways

• superpathway of pyrimidine nucleobases salvage (4/4 steps found)
• pyrimidine nucleobases salvage II (2/2 steps found)
• pyrimidine nucleobases salvage I (1/1 steps found)
• superpathway of pyrimidine ribonucleosides salvage (6/10 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.9

Use Curated BLAST to search for 2.4.2.9

Sequence Analysis Tools

See A0A0C4YCT5 at UniProt or InterPro

Protein Sequence (175 amino acids)

>RR42_RS15865 uracil phosphoribosyltransferase (Cupriavidus basilensis FW507-4G11)
MTQTSSLDAEALYRTLRDQLQAALPEAERVQWSVAGIYSGGAWIAERLAADLQLAAHGVI
NVAFHRDDYAKKGLHSQAQPTTLPFDVQDRKILLIDDVLATGRTIRAAVNELFDYGRPAR
VALAVLVDRGGRELPAAADFAAAHVALPPGTTLVLSHEGTGSDMRFAFANEATGN