Protein Info for RR42_RS15860 in Cupriavidus basilensis FW507-4G11

Annotation: aspartate carbamoyltransferase catalytic subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 PF02729: OTCace_N" amino acids 17 to 163 (147 residues), 147.3 bits, see alignment E=3.6e-47 TIGR00670: aspartate carbamoyltransferase" amino acids 17 to 318 (302 residues), 310.5 bits, see alignment E=5.5e-97 PF00185: OTCace" amino acids 171 to 315 (145 residues), 92.4 bits, see alignment E=3.2e-30

Best Hits

Swiss-Prot: 98% identical to PYRB_CUPMC: Aspartate carbamoyltransferase (pyrB) from Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)

KEGG orthology group: K00609, aspartate carbamoyltransferase catalytic subunit [EC: 2.1.3.2] (inferred from 98% identity to rme:Rmet_2740)

Predicted SEED Role

"Aspartate carbamoyltransferase (EC 2.1.3.2)" in subsystem De Novo Pyrimidine Synthesis (EC 2.1.3.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YF46 at UniProt or InterPro

Protein Sequence (323 amino acids)

>RR42_RS15860 aspartate carbamoyltransferase catalytic subunit (Cupriavidus basilensis FW507-4G11)
MIKTFRNPQLTKNGELKHLLSIEGLSREMVAHILDTASQFVSLSDSDREVKKVPLLRGKS
VFNLFFENSTRTRTTFEIAAKRLSADVLNLNINASSTSKGESLLDTINNLSAMSADMFVV
RHASSGAPYLIAEHVAPHVHVINAGDGRHAHPTQGLLDMYTIRHYKKDFTNLTVAIVGDI
LHSRVARSDIHALTTLGVPEVRAIGPRTLLPSGLEQMGVRVFHNMEEGMKGVDVVIMLRL
QNERMSGALLPSAQEYFKAYGLTPERLALAKPDAIVMHPGPMNRGVEIDSAVADGPQSVI
LNQVTFGIAVRMAVMGIVAGNHD