Protein Info for RR42_RS15835 in Cupriavidus basilensis FW507-4G11

Annotation: dTDP-4-dehydrorhamnose reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01214: dTDP-4-dehydrorhamnose reductase
  • amino acids 10 to 302 (293 residues), 324.9 bits, E=1.9e-101
• PF04321: RmlD_sub_bind
  • amino acids 10 to 303 (294 residues), 332.7 bits, E=3.3e-103
• PF01370: Epimerase
  • amino acids 12 to 171 (160 residues), 80.6 bits, E=2.4e-26
• PF16363: GDP_Man_Dehyd
  • amino acids 41 to 144 (104 residues), 43 bits, E=8.7e-15
• PF02719: Polysacc_synt_2
  • amino acids 42 to 163 (122 residues), 25.3 bits, E=1.6e-09

Best Hits

KEGG orthology group: K00067, dTDP-4-dehydrorhamnose reductase [EC: 1.1.1.133] (inferred from 70% identity to rso:RSc0683)

Predicted SEED Role

"dTDP-4-dehydrorhamnose reductase (EC 1.1.1.133)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 1.1.1.133)

MetaCyc Pathways

• O-antigen building blocks biosynthesis (E. coli) (10/11 steps found)
• dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (5/19 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)

KEGG Metabolic Maps

• Polyketide sugar unit biosynthesis
• Streptomycin biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.133

Sequence Analysis Tools

See A0A0C4YF36 at UniProt or InterPro

Protein Sequence (305 amino acids)

>RR42_RS15835 dTDP-4-dehydrorhamnose reductase (Cupriavidus basilensis FW507-4G11)
MPDKARRIPTLLVTGSNGQVGFELRRALSPLGHVIALDRRACDLSRPEEVRRVLRKQRPD
VIVNAAAYTSMDRAEADIENAYAVNATAVGILAEEALALGSLLVHYSTDCVFDGCQTTPY
AETDAVNPVSVYGKSKLAGEQAIAEVAPTALILRTSWVAGIHGNNFVKTMLRLGAMQPAL
RVVGDRFGAPTGAALVADVTAQIVARAWLLGDSGAFAAGIYHLAAAGETSWHGYASEVLR
YAAAQGAVLKTDPDRIEEIAASDYPLPAPRPANARLDTAKIRRTFGIHLPDWRMGVHHLL
DQFLA