Protein Info for RR42_RS15825 in Cupriavidus basilensis FW507-4G11

Annotation: capsular biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 638 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 48 to 67 (20 residues), see Phobius details amino acids 79 to 102 (24 residues), see Phobius details amino acids 111 to 129 (19 residues), see Phobius details PF13727: CoA_binding_3" amino acids 65 to 238 (174 residues), 62.3 bits, see alignment E=1.5e-20 PF02719: Polysacc_synt_2" amino acids 283 to 576 (294 residues), 412.4 bits, see alignment E=2.5e-127 PF01370: Epimerase" amino acids 283 to 508 (226 residues), 57.6 bits, see alignment E=3.2e-19 PF16363: GDP_Man_Dehyd" amino acids 284 to 411 (128 residues), 28.6 bits, see alignment E=2.6e-10

Best Hits

KEGG orthology group: None (inferred from 81% identity to rpf:Rpic12D_0577)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y5D2 at UniProt or InterPro

Protein Sequence (638 amino acids)

>RR42_RS15825 capsular biosynthesis protein (Cupriavidus basilensis FW507-4G11)
MLKKISEMSRQKKILLMLVLDFFLLPLSLWSAVGLRTDHWAVSSQYPISLYFVTSLVAIP
VFVKLGLYRSVVRYMEDRAILTIVVAVTISIGMFGSLIFFLGLSNVPRGALLIYWLLAIV
YIVCSRFFVRAAFRMLPSFGRHGQKVIIYGAGDAGRQLAVALGVGSDYEPMAFVDDDIKK
RGLSIAGIKVHGADELPELVRRFAIHQVLIAIPSASRSRRIEIVNALEPLAVEVRAVPGM
AEMVSGEVRLDDVREVEIDELLGRDVVAPNMKLLMENIAGKSVMVTGAGGSIGSELCRQI
IKNKPARLVLYEQSEFALYALEYELQQTVTEKELPIELVPVLGSVQNGERVFGIMSRYGV
QTIYHAAAYKHVPIVEFNMTEGILNNTVGTRITAEAAIRANVEAFVLISTDKAVRPTNVM
GASKRMAELCLQAFAQDPNVRTRFSIVRFGNVLGSSGSVVPLFRTQIAAGGPVTVTHPDI
IRYFMTIPEAAQLVIQAGAMGGEGEVFVLDMGQPVKIVDLARRMIHLSGFQVKDEVNPDG
DIEIQFTGLRPGEKLYEELLIGDAVSGTGHPRIMKADESFLSREQLDEKMKCLIQASDSN
DCETIRTILLECVSGFRPDRDIKDHLHEEPAPRIRLLR