Protein Info for RR42_RS15810 in Cupriavidus basilensis FW507-4G11

Annotation: UDP-N-acetylglucosamine 4,6-dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03589: UDP-N-acetylglucosamine 4,6-dehydratase (inverting)
  • amino acids 1 to 327 (327 residues), 549.5 bits, E=1e-169
• PF04321: RmlD_sub_bind
  • amino acids 6 to 193 (188 residues), 36.5 bits, E=9.2e-13
• PF02719: Polysacc_synt_2
  • amino acids 7 to 279 (273 residues), 345.2 bits, E=8.6e-107
• PF01370: Epimerase
  • amino acids 7 to 221 (215 residues), 87.5 bits, E=2.8e-28
• PF01073: 3Beta_HSD
  • amino acids 8 to 131 (124 residues), 53.4 bits, E=6.2e-18
• PF16363: GDP_Man_Dehyd
  • amino acids 8 to 222 (215 residues), 43.4 bits, E=9.7e-15
• PF13460: NAD_binding_10
  • amino acids 11 to 130 (120 residues), 36.1 bits, E=1.9e-12

Best Hits

Swiss-Prot: 68% identical to PSEB_CAMJE: UDP-N-acetylglucosamine 4,6-dehydratase (inverting) (pseB) from Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)

KEGG orthology group: None (inferred from 94% identity to rpf:Rpic12D_0580)

MetaCyc: 63% identical to UDP-N-acetylglucosamine 4,6-dehydratase subunit (Helicobacter pylori 26695)
UDP-N-acetylglucosamine 4,6-dehydratase (inverting). [EC: 4.2.1.115]

Predicted SEED Role

"UDP-N-acetylglucosamine 4,6-dehydratase (EC 4.2.1.-)" in subsystem N-linked Glycosylation in Bacteria (EC 4.2.1.-)

MetaCyc Pathways

• CMP-pseudaminate biosynthesis (5/6 steps found)
• UDP-N-acetyl-β-L-fucosamine biosynthesis (1/4 steps found)
• UDP-N-acetyl-β-L-quinovosamine biosynthesis (1/4 steps found)
• CMP-diacetamido-8-epilegionaminic acid biosynthesis (1/7 steps found)
• superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (6/24 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Fatty acid biosynthesis
• Limonene and pinene degradation
• Nucleotide sugars metabolism
• Phenylalanine, tyrosine and tryptophan biosynthesis
• Porphyrin and chlorophyll metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.-

Use Curated BLAST to search for 4.2.1.- or 4.2.1.115

Sequence Analysis Tools

See A0A0C4YF28 at UniProt or InterPro

Protein Sequence (333 amino acids)

>RR42_RS15810 UDP-N-acetylglucosamine 4,6-dehydratase (Cupriavidus basilensis FW507-4G11)
MFNNKSILITGGTGSFGRKYARTILARYKPKRLVIYSRDELKQFEMQQDIDAPPMRYFIG
DVRDGDRLSQAMRGIDYVIHAAALKQVPAAEYNPLECIKTNIHGAENVINAAIANNVHKV
IALSTDKAANPINLYGATKLASDKLFVAANNMVGANQTSFAVVRYGNVVGSRGSVVPFFE
QLLARGEKELPITHAEMTRFWISLQDGVDFVLKNFERMHGGEIFVPKIPSIRITDLAEAV
APGVATRVIGIRPGEKLHEIMCPSDDSHLTLEFSDHYVLRPTIKFHHSDIDYTVNALGEQ
GEQVSQGFEYNSGNNPHFLSPEEIREFNAKAMA