Protein Info for RR42_RS15605 in Cupriavidus basilensis FW507-4G11

Annotation: poly(3-hydroxybutyrate) depolymerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 TIGR01849: polyhydroxyalkanoate depolymerase, intracellular" amino acids 3 to 400 (398 residues), 500.6 bits, see alignment E=1.5e-154 PF06850: PHB_depo_C" amino acids 202 to 402 (201 residues), 289.7 bits, see alignment E=5.2e-91

Best Hits

KEGG orthology group: None (inferred from 76% identity to reu:Reut_A0762)

Predicted SEED Role

"Poly-beta-hydroxyalkanoate depolymerase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y580 at UniProt or InterPro

Protein Sequence (404 amino acids)

>RR42_RS15605 poly(3-hydroxybutyrate) depolymerase (Cupriavidus basilensis FW507-4G11)
MLYQVYQTYADFMQPACSLADMVSNTLAENPRLAGCEPMLATRAACEVLALSRLTHHRPP
FAIDSVMVNGTPVQVTEEVTASTPFCSLLHFRKHGVYDHPRVLLVAPMSGHFATLLRGTV
QTMLRDHDVYITDWHNPRDISLAHGRFGFDEYVYHLIDFLRVLGGGTHLMAVCQPTVAAL
AAVALMAEDSDPAQPPSLILMAGPIDARINPTKVNELATSQPIEWFERSLTSYVPFRFAG
AMRRVYPGFMQLIAFMSMNSERHQQAFRDLYDLRASGQHDRADAIQVFYEEYFATMDLSA
EFYLETVSMVFQEFLLAQGLLDVGGRRVNPHAIHRTALLTVEGERDDICAIGQTMAAQEL
CGSLRPYMRMHHVQTGVGHYGVFNGKRWDSQVYPLVRNAVHMNA