Protein Info for RR42_RS15455 in Cupriavidus basilensis FW507-4G11

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 168 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR02802: peptidoglycan-associated lipoprotein" amino acids 65 to 168 (104 residues), 140.6 bits, see alignment E=8.7e-46 PF00691: OmpA" amino acids 67 to 162 (96 residues), 73.3 bits, see alignment E=8.8e-25

Best Hits

KEGG orthology group: K03640, peptidoglycan-associated lipoprotein (inferred from 84% identity to reu:Reut_A0796)

Predicted SEED Role

"18K peptidoglycan-associated outer membrane lipoprotein; Peptidoglycan-associated lipoprotein precursor; Outer membrane protein P6; OmpA/MotB precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YCG5 at UniProt or InterPro

Protein Sequence (168 amino acids)

>RR42_RS15455 membrane protein (Cupriavidus basilensis FW507-4G11)
MMTKTLAVAALLALGACSSGVKLDDTANAGAGNKGTPSTDARAVAPVDVSRDPLNDPNSP
LAKRSVYFDFDSYSVKSDYQGMLSEHAKYLAANKGRRILIQGNTDDRGTSEYNLALGQKR
AEAVRRSLSSLGVPETQMEAVSLGKEKPKATGHDEAAWAENRRADITY