Protein Info for RR42_RS15425 in Cupriavidus basilensis FW507-4G11

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 transmembrane" amino acids 6 to 38 (33 residues), see Phobius details amino acids 58 to 80 (23 residues), see Phobius details amino acids 154 to 171 (18 residues), see Phobius details amino acids 207 to 228 (22 residues), see Phobius details amino acids 234 to 264 (31 residues), see Phobius details amino acids 271 to 293 (23 residues), see Phobius details amino acids 306 to 333 (28 residues), see Phobius details PF01594: AI-2E_transport" amino acids 6 to 334 (329 residues), 182.6 bits, see alignment E=6e-58

Best Hits

KEGG orthology group: None (inferred from 72% identity to axy:AXYL_01931)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YCF7 at UniProt or InterPro

Protein Sequence (385 amino acids)

>RR42_RS15425 membrane protein (Cupriavidus basilensis FW507-4G11)
MQQKAFYLLLAVVSIAFCFVLRPFFGAVFWGAILAIIFTPPNNWLTRRMGDRRNLASLTT
LTLCLLIVVLPLIFVTGALIQEGSTVYQQIKSGQLNFGAYFQQALHALPPSVTRVLGRFG
LTDISDLQQKLTAGAAQASQILAAQALSIGQNTFQFLVSFGVMLYLLFFLLRDGPQLSKI
IMRAIPLSEPHKQHLLRKFTTVARATVKGNIAVAAVQGALGGLAFWFLGIQGSLLWGVLM
GFLSLLPAVGAALIWGPVGIYFLLTGDVGKGSILIGFCAVVIGAVDNVLRPILVGKDTRM
PDWVVLISTLGGMALFGLSGFVIGPLIAALFIASWDLSTSTREEIERRDAAHDKDQPPPP
PPAPPTGATGQASAQAPGPEAARTD