Protein Info for RR42_RS15170 in Cupriavidus basilensis FW507-4G11

Annotation: peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 576 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 30 to 51 (22 residues), see Phobius details amino acids 57 to 76 (20 residues), see Phobius details amino acids 91 to 113 (23 residues), see Phobius details amino acids 119 to 139 (21 residues), see Phobius details amino acids 163 to 182 (20 residues), see Phobius details amino acids 188 to 211 (24 residues), see Phobius details amino acids 224 to 253 (30 residues), see Phobius details amino acids 273 to 291 (19 residues), see Phobius details amino acids 298 to 322 (25 residues), see Phobius details amino acids 334 to 354 (21 residues), see Phobius details amino acids 363 to 386 (24 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 13 to 384 (372 residues), 164.9 bits, see alignment E=2.5e-52 PF03471: CorC_HlyC" amino acids 493 to 566 (74 residues), 45.1 bits, see alignment E=8.3e-16

Best Hits

KEGG orthology group: K11105, cell volume regulation protein A (inferred from 82% identity to reh:H16_A2773)

Predicted SEED Role

"Na+/H+ antiporter" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y4Y8 at UniProt or InterPro

Protein Sequence (576 amino acids)

>RR42_RS15170 peptidase (Cupriavidus basilensis FW507-4G11)
MESIDHVILIGAVVMSLGIVVGAFSARVGVPFLLVFLSVGMLAGVDGPGGIRFSNTWLSF
LVGNLALAVILLDGGLRTRLATFRVALKPSLSLATVGVLVTTGLVGLFAAWVLEIDWKLG
LLLGAIVGSTDAAAVFSLLNTSGIRLKERVASVLEIESGINDPMAIFLTLTLIDWIAAPA
GLSPGALLWRLVVQFGVGGLLGLGLGYCMANVMERIRVAEGLQAILLCSGGAMVFAIVQT
AGGSGFLAVYLTGILVGNRDRAVGPDTMRAMDGMAWLSQSAMFLLLGLLVAPHRIWEVAL
PAVAVAAFLMLVARPAAVWLALLPFRFSAREKGFVAWMGLRGAVPIVLALFPMLQGMPDS
GLLFRIAFAVVLTSLLLQGTTVPLAARLARVLRPAYPEPLARSRLRGTHGPALEVMQFRV
EADSPAEDLRADQLELPPRCRLLTVVRDEALAAPDQTVLRDGDMVSILAPGTSVPMLALL
FHRPGPALAWGKASHDFLLSGEAMLRDVAGLYGTRELSPAEAARTLEAAMQEAFTSPPVE
GDAVEIAGLKLTVTRMDGPRIIQVGLLLPRAEQEAA