Protein Info for RR42_RS15140 in Cupriavidus basilensis FW507-4G11

Annotation: serine protease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 478 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 268 to 288 (21 residues), see Phobius details amino acids 295 to 314 (20 residues), see Phobius details amino acids 319 to 338 (20 residues), see Phobius details amino acids 343 to 361 (19 residues), see Phobius details amino acids 372 to 393 (22 residues), see Phobius details PF01957: NfeD" amino acids 379 to 459 (81 residues), 56.5 bits, see alignment E=1.5e-19

Best Hits

KEGG orthology group: K07403, membrane-bound serine protease (ClpP class) (inferred from 71% identity to reu:Reut_A0853)

Predicted SEED Role

"Putative membrane-bound ClpP-class protease associated with aq_911" in subsystem YbbK

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YC60 at UniProt or InterPro

Protein Sequence (478 amino acids)

>RR42_RS15140 serine protease (Cupriavidus basilensis FW507-4G11)
MLLRWLATAVWLALAALVATPLVPATLANAQASANAAAGAVPPVFVIPLKGAIGPASASF
IERGMARARDAGAQLIVLEMDTPGGLDLSMREIIQGILASPVPVASYVYPGGARAASAGT
YILYASHIAAMAPGTNLGAASPVQIGIGGPQKPEAAPGSASAPAGAPPQDTMERKQMHDA
SAYIRGLAQLRGRNAEWGERAVREAVSLSASEAVAQKVADLIAPDLPALLRAVDGKHIQA
AGTERVLRTAHAPVQVLEPDWRDSFLEVITDPSVALILMMAGIYGLIFEFSTPGMVVPGI
GGAICLLLALFALHMLPVSYAGLGLIALGIGCMVAELYLPTFGALGVGGIIAFIFGAVML
IDTNVPGFGIPLWLIGSLALASAVFLFAVWTLLWRARRMPSINGGDAMIGMPGVVLEDLW
DDGWAEIRGERWQVHSAMPMTHGQRVLVIGRHGLLLEVRAMDGAQASATPIPPSTQGA