Protein Info for RR42_RS15105 in Cupriavidus basilensis FW507-4G11

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01206: TusA
  • amino acids 5 to 74 (70 residues), 89.9 bits, E=3.9e-30

Best Hits

Swiss-Prot: 58% identical to TUSA_ALLVD: Sulfur carrier protein TusA (tusA) from Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D)

KEGG orthology group: K04085, tRNA 2-thiouridine synthesizing protein A [EC: 2.8.1.-] (inferred from 96% identity to cti:RALTA_A2252)

MetaCyc: 58% identical to TusA sulfur-carrier protein (Allochromatium vinosum)
2.8.1.-

Predicted SEED Role

"Molybdopterin biosynthesis protein MoeB" in subsystem Molybdenum cofactor biosynthesis

MetaCyc Pathways

• sulfur oxidation IV (intracellular sulfur) (2/7 steps found)
• superpathway of sulfide oxidation (phototrophic sulfur bacteria) (3/12 steps found)

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.-

Use Curated BLAST to search for 2.8.1.-

Sequence Analysis Tools

See A0A0C4YBY7 at UniProt or InterPro

Protein Sequence (75 amino acids)

>RR42_RS15105 transcriptional regulator (Cupriavidus basilensis FW507-4G11)
MEFQKEVDARGLNCPLPILRTKKALADMPSGDVLKILATDPGATRDFQAFAKQTGNELLS
HQEVDKVFVFYMRRR