Protein Info for RR42_RS15035 in Cupriavidus basilensis FW507-4G11

Annotation: ZIP zinc transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 50 to 69 (20 residues), see Phobius details amino acids 160 to 181 (22 residues), see Phobius details amino acids 187 to 208 (22 residues), see Phobius details amino acids 220 to 238 (19 residues), see Phobius details PF02535: Zip" amino acids 16 to 89 (74 residues), 35.8 bits, see alignment E=2.9e-13 amino acids 75 to 237 (163 residues), 101.6 bits, see alignment E=2.6e-33

Best Hits

KEGG orthology group: None (inferred from 92% identity to reh:H16_A2738)

Predicted SEED Role

"Zinc transporter, ZIP family" in subsystem Transport of Zinc

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y4V8 at UniProt or InterPro

Protein Sequence (258 amino acids)

>RR42_RS15035 ZIP zinc transporter (Cupriavidus basilensis FW507-4G11)
MGSIFGAALLSLTVASRVVERMVSFSVGVLLATALLHSLPEAFESGADPRALFGTLLAGL
LGFFLLEKVALLRHSHHHEGDGHHHHHGHDREEAGRSGMTILVGDTFHNFADGIVIAAAF
LADPHIGLVTALAIAAHEIPQEVGDFIVLLNAGFSKARAFAFNLLSSLAAIAGGVVGYYL
LDQMSGWIPYVLVIASSSFVYIAVSDLMPQMQRKPRWRESIIQVVLVATGICAIFFITNG
VHEAHGHGHAHGVAAAAR