Protein Info for RR42_RS15015 in Cupriavidus basilensis FW507-4G11

Annotation: exodeoxyribonuclease VII small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01280: exodeoxyribonuclease VII, small subunit
  • amino acids 27 to 81 (55 residues), 76.6 bits, E=6e-26
• PF02609: Exonuc_VII_S
  • amino acids 28 to 78 (51 residues), 75.2 bits, E=1.6e-25

Best Hits

Swiss-Prot: 72% identical to EX7S_RALSO: Exodeoxyribonuclease 7 small subunit (xseB) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K03602, exodeoxyribonuclease VII small subunit [EC: 3.1.11.6] (inferred from 77% identity to reu:Reut_A0880)

Predicted SEED Role

"Exodeoxyribonuclease VII small subunit (EC 3.1.11.6)" in subsystem DNA repair, bacterial (EC 3.1.11.6)

Isozymes

Compare fitness of predicted isozymes for: 3.1.11.6

Use Curated BLAST to search for 3.1.11.6

Protein Sequence (96 amino acids)

>RR42_RS15015 exodeoxyribonuclease VII small subunit (Cupriavidus basilensis FW507-4G11)
MPKTTSSPAQADPAATDQRSASAPPASYEAAMAELEALVASMEGGALPLEDSLAAYKRGA
ELVRYCQQMLERVEQQVKVLEGDVLKPMAADAGDLE