Protein Info for RR42_RS14965 in Cupriavidus basilensis FW507-4G11

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 758 PF03979: Sigma70_r1_1" amino acids 139 to 217 (79 residues), 98.7 bits, see alignment E=4.6e-32 PF00140: Sigma70_r1_2" amino acids 234 to 266 (33 residues), 50 bits, see alignment (E = 6.9e-17) PF04546: Sigma70_ner" amino acids 275 to 492 (218 residues), 222.6 bits, see alignment E=1.6e-69 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 519 to 744 (226 residues), 131.8 bits, see alignment E=1.8e-42 TIGR02393: RNA polymerase sigma factor RpoD" amino acids 519 to 755 (237 residues), 394.2 bits, see alignment E=2.2e-122 PF04542: Sigma70_r2" amino acids 525 to 593 (69 residues), 80.2 bits, see alignment E=2.4e-26 PF04539: Sigma70_r3" amino acids 602 to 678 (77 residues), 89.3 bits, see alignment E=4.3e-29 PF04545: Sigma70_r4" amino acids 691 to 744 (54 residues), 66.9 bits, see alignment 2.6e-22

Best Hits

KEGG orthology group: K03086, RNA polymerase primary sigma factor (inferred from 89% identity to reh:H16_A2725)

Predicted SEED Role

"RNA polymerase sigma factor RpoD" in subsystem Flagellum or Macromolecular synthesis operon or Transcription factors cyanobacterial RpoD-like sigma factors or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YBV8 at UniProt or InterPro

Protein Sequence (758 amino acids)

>RR42_RS14965 hypothetical protein (Cupriavidus basilensis FW507-4G11)
MKGKSITVAKQQNTEVESKKAAATSAKTGDAKPGAAEPEATPNATTSAPVASERPAAPAV
KPEPKKRGRKPKAGAQRDDSTPDDVTEELYEDEIPAAATPTAAPKSDKQKARDRKAKEKA
LLKEFASTQQGTEEELEVRRQKLKALIKLGKSRGYLTYAEINDHLPDDMVDSETIDTLVA
TLNDIGIAVYEQAPDAETLLLNDNAPSATSEEEAEEEAEAALSTVDSEFGRTTDPVRMYM
REMGTVELLTREGEIEIAKRIEAGLKDMVMAISACPVTISEILALAERVASDEIKIDEFV
DGLIDPNAADVPVAPPAPAVVAAAEEDELESDGEESDEDEDEDAGGLAASARQLEELKLA
ALEKFRVIAEQFDKMRRSFEKEGYKSKSYVKAQEAILNELMSIRFTARNVERLCDTLRGQ
VDEVRKLERSILKIVVDKCGMPRADFVARFPGNETNLEWIDTIIKDGKPYSTIVERNVPA
VRELQQKLIDLQMRVVLPLKELKEVNRKMSEGEKRAREAKREMTEANLRLVISIAKKYTN
RGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHM
IETINKMNRISRQILQETGNEPDPATLAEKMEMPEDKIRKIMKIAKEPISMETPIGDDDD
SHLGDFIEDTNTLAPAEAALHGSMRDVVKDVLDSLTPREAKVLRMRFGIEMSTDHTLEEV
GKQFDVTRERIRQIEAKALRKLRHPSRSDKLKSFLEGS