Protein Info for RR42_RS14930 in Cupriavidus basilensis FW507-4G11

Annotation: biopolymer transporter ExbD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 136 transmembrane" amino acids 19 to 40 (22 residues), see Phobius details PF02472: ExbD" amino acids 10 to 132 (123 residues), 102.7 bits, see alignment E=8.1e-34

Best Hits

Swiss-Prot: 31% identical to EXBD_PSEAE: Biopolymer transport protein ExbD (exbD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03559, biopolymer transport protein ExbD (inferred from 96% identity to mms:mma_2378)

Predicted SEED Role

"Biopolymer transport protein ExbD/TolR" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YI37 at UniProt or InterPro

Protein Sequence (136 amino acids)

>RR42_RS14930 biopolymer transporter ExbD (Cupriavidus basilensis FW507-4G11)
MAYAAKFGTKKRTGGINITPFVDVLLVVLVIFILTSNASIPGIKVDLPKASSSVALEKPK
TKAITIDNAGQVFLDAYPVTLPELEERLRTEKALTPDFPVIVRGDAAVQYAKVVEVLDLL
RRIDLNQIGLVTGKPA