Protein Info for RR42_RS14760 in Cupriavidus basilensis FW507-4G11

Annotation: molybdenum cofactor biosynthesis protein MogA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00177: molybdenum cofactor synthesis domain
  • amino acids 2 to 146 (145 residues), 114.3 bits, E=2.3e-37
• PF00994: MoCF_biosynth
  • amino acids 4 to 145 (142 residues), 85.4 bits, E=1.6e-28

Best Hits

Swiss-Prot: 66% identical to MOG_SHIFL: Molybdopterin adenylyltransferase (mog) from Shigella flexneri

KEGG orthology group: K03831, molybdopterin adenylyltransferase (inferred from 90% identity to cti:RALTA_A2198)

MetaCyc: 66% identical to molybdopterin adenylyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-8344 [EC: 2.7.7.75]

Predicted SEED Role

"Molybdopterin biosynthesis molybdochelatase MogA"

MetaCyc Pathways

• molybdenum cofactor biosynthesis (3/3 steps found)
• bis(tungstenpterin) cofactor biosynthesis (1/4 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.75

Sequence Analysis Tools

See A0A0C4YI12 at UniProt or InterPro

Protein Sequence (196 amino acids)

>RR42_RS14760 molybdenum cofactor biosynthesis protein MogA (Cupriavidus basilensis FW507-4G11)
MVGFVSISDRASTGTYQDEGIPALRDWFGRALSSPWQAVERLIPDEQALISRTLIELVDV
AGCDLVLTTGGTGPARRDVTPEATLAVGTKEMPGFGEQMRQVSLHFVPTAILSRQVAVIR
ETASRAALIINLPGQPRAIRETLEGLRGKDGESIVQGIFAAVPYCIDLIGGPYIETDEAV
AKVWRPKHAIRARPAA